PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID TRAES3BF267200010CFD_t1
Common NameTRAES_3BF267200010CFD_c1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 239aa    MW: 26265 Da    PI: 7.4963
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
TRAES3BF267200010CFD_t1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY96.22.2e-30118175158
                              ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS CS
                     WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnh 58 
                              ldDgy+WrKYG+K+vk+s++pr+YYrC+s+gC+vkk+ver+++d+++v++tY g H+h
  TRAES3BF267200010CFD_t1 118 LDDGYRWRKYGKKMVKNSPNPRNYYRCSSEGCRVKKRVERDRDDERFVITTYDGVHDH 175
                              59*******************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.6E-32105176IPR003657WRKY domain
SuperFamilySSF1182904.84E-27111176IPR003657WRKY domain
PROSITE profilePS5081131.674113178IPR003657WRKY domain
SMARTSM007748.4E-35118177IPR003657WRKY domain
PfamPF031061.1E-23119175IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MSSYSSLLSV SPGEQIGGYA DGGDHDDMAA AANYLSSFCF DFGEEYYSLA EAATASYPLH  60
AQQQQPPTQA DSHHSGKAAS TTSSSQGLDN INTSLTSSDA RSKGSKIAFK TRSEMEVLDD  120
GYRWRKYGKK MVKNSPNPRN YYRCSSEGCR VKKRVERDRD DERFVITTYD GVHDHLAPLP  180
PRGCAGYSLS LAQTRVDEGS SPLPVQGRRC FLDTMKMHAA GSQQGCTPVP QPRKLERDN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-25105178174WRKY transcription factor 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKT7289090.0KT728909.1 Triticum aestivum clone LKc001 WRKY protein mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003566817.18e-70PREDICTED: probable WRKY transcription factor 75
TrEMBLW5D5G91e-180W5D5G9_WHEAT; Uncharacterized protein
STRINGSi002862m4e-50(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44137206
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.16e-29WRKY DNA-binding protein 50
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]